Faster access than browser!
9 relations: Apoptosis, Chromosome 17, Enterocyte, G protein–coupled receptor, Gene, Glucagon-like peptide 1 receptor, Glucagon-like peptide-1, Glucagon-like peptide-2, Protein.
Apoptosis
Apoptosis (from Ancient Greek ἀπόπτωσις "falling off") is a process of programmed cell death that occurs in multicellular organisms.
New!!: Glucagon-like peptide 2 receptor and Apoptosis · See more »
Chromosome 17
Chromosome 17 is one of the 23 pairs of chromosomes in humans.
New!!: Glucagon-like peptide 2 receptor and Chromosome 17 · See more »
Enterocyte
Enterocytes, or intestinal absorptive cells, are simple columnar epithelial cells found in the small intestine.
New!!: Glucagon-like peptide 2 receptor and Enterocyte · See more »
G protein–coupled receptor
G protein–coupled receptors (GPCRs), also known as seven-(pass)-transmembrane domain receptors, 7TM receptors, heptahelical receptors, serpentine receptor, and G protein–linked receptors (GPLR), constitute a large protein family of receptors that detect molecules outside the cell and activate internal signal transduction pathways and, ultimately, cellular responses.
New!!: Glucagon-like peptide 2 receptor and G protein–coupled receptor · See more »
Gene
In biology, a gene is a sequence of DNA or RNA that codes for a molecule that has a function.
New!!: Glucagon-like peptide 2 receptor and Gene · See more »
Glucagon-like peptide 1 receptor
The glucagon-like peptide 1 receptor (GLP1R) is a receptor protein found on beta cells of the pancreas.
New!!: Glucagon-like peptide 2 receptor and Glucagon-like peptide 1 receptor · See more »
Glucagon-like peptide-1
Glucagon-like peptide-1 (GLP-1) is a 30 amino acid long peptide hormone deriving from the tissue-specific posttranslational processing of the proglucagon peptide.
New!!: Glucagon-like peptide 2 receptor and Glucagon-like peptide-1 · See more »
Glucagon-like peptide-2
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans.
New!!: Glucagon-like peptide 2 receptor and Glucagon-like peptide-2 · See more »
Protein
Proteins are large biomolecules, or macromolecules, consisting of one or more long chains of amino acid residues.
New!!: Glucagon-like peptide 2 receptor and Protein · See more »
Redirects here:
GLP-2R, GLP2R, GLP2R (gene), Glucagon-like peptide-2 receptor.
References
[1] https://en.wikipedia.org/wiki/Glucagon-like_peptide_2_receptor
