Enteroendocrine cell and Glucagon-like peptide-2

Shortcuts: Differences, Similarities, Jaccard Similarity Coefficient, References.

Difference between Enteroendocrine cell and Glucagon-like peptide-2

Enteroendocrine cell vs. Glucagon-like peptide-2

Enteroendocrine cells are specialized cells of the gastrointestinal tract and pancreas with endocrine function. Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans.

Similarities between Enteroendocrine cell and Glucagon-like peptide-2

Enteroendocrine cell and Glucagon-like peptide-2 have 3 things in common (in Unionpedia): Endocrine system, Gastrointestinal tract, Glucagon-like peptide-1.

Endocrine system

The endocrine system is a chemical messenger system consisting of hormones, the group of glands of an organism that carry those hormones directly into the circulatory system to be carried towards distant target organs, and the feedback loops of homeostasis that the hormones drive.

Endocrine system and Enteroendocrine cell · Endocrine system and Glucagon-like peptide-2 · See more »

Gastrointestinal tract

The gastrointestinal tract (digestive tract, digestional tract, GI tract, GIT, gut, or alimentary canal) is an organ system within humans and other animals which takes in food, digests it to extract and absorb energy and nutrients, and expels the remaining waste as feces.

Enteroendocrine cell and Gastrointestinal tract · Gastrointestinal tract and Glucagon-like peptide-2 · See more »

Glucagon-like peptide-1

Glucagon-like peptide-1 (GLP-1) is a 30 amino acid long peptide hormone deriving from the tissue-specific posttranslational processing of the proglucagon peptide.

Enteroendocrine cell and Glucagon-like peptide-1 · Glucagon-like peptide-1 and Glucagon-like peptide-2 · See more »

The list above answers the following questions

What Enteroendocrine cell and Glucagon-like peptide-2 have in common
What are the similarities between Enteroendocrine cell and Glucagon-like peptide-2

Enteroendocrine cell and Glucagon-like peptide-2 Comparison

Enteroendocrine cell has 52 relations, while Glucagon-like peptide-2 has 17. As they have in common 3, the Jaccard index is 4.35% = 3 / (52 + 17).

References

This article shows the relationship between Enteroendocrine cell and Glucagon-like peptide-2. To access each article from which the information was extracted, please visit:

Unionpedia is a concept map or semantic network organized like an encyclopedia – dictionary. It gives a brief definition of each concept and its relationships.

This is a giant online mental map that serves as a basis for concept diagrams. It's free to use and each article or document can be downloaded. It's a tool, resource or reference for study, research, education, learning or teaching, that can be used by teachers, educators, pupils or students; for the academic world: for school, primary, secondary, high school, middle, technical degree, college, university, undergraduate, master's or doctoral degrees; for papers, reports, projects, ideas, documentation, surveys, summaries, or thesis. Here is the definition, explanation, description, or the meaning of each significant on which you need information, and a list of their associated concepts as a glossary. Available in English, Spanish, Portuguese, Japanese, Chinese, French, German, Italian, Polish, Dutch, Russian, Arabic, Hindi, Swedish, Ukrainian, Hungarian, Catalan, Czech, Hebrew, Danish, Finnish, Indonesian, Norwegian, Romanian, Turkish, Vietnamese, Korean, Thai, Greek, Bulgarian, Croatian, Slovak, Lithuanian, Filipino, Latvian, Estonian and Slovenian. More languages soon.

All the information was extracted from Wikipedia, and it's available under the Creative Commons Attribution-ShareAlike License.

Unionpedia is not endorsed by or affiliated with the Wikimedia Foundation.

Google Play, Android and the Google Play logo are trademarks of Google Inc.