Faster access than browser!Similarities between Glucagon-like peptide 2 receptor and Neurotransmitter
Glucagon-like peptide 2 receptor and Neurotransmitter have 4 things in common (in Unionpedia): G protein–coupled receptor, Glucagon-like peptide 1 receptor, Glucagon-like peptide-1, Glucagon-like peptide-2.
G protein–coupled receptor
G protein–coupled receptors (GPCRs), also known as seven-(pass)-transmembrane domain receptors, 7TM receptors, heptahelical receptors, serpentine receptor, and G protein–linked receptors (GPLR), constitute a large protein family of receptors that detect molecules outside the cell and activate internal signal transduction pathways and, ultimately, cellular responses.
G protein–coupled receptor and Glucagon-like peptide 2 receptor · G protein–coupled receptor and Neurotransmitter ·
Glucagon-like peptide 1 receptor
The glucagon-like peptide 1 receptor (GLP1R) is a receptor protein found on beta cells of the pancreas.
Glucagon-like peptide 1 receptor and Glucagon-like peptide 2 receptor · Glucagon-like peptide 1 receptor and Neurotransmitter ·
Glucagon-like peptide-1
Glucagon-like peptide-1 (GLP-1) is a 30 amino acid long peptide hormone deriving from the tissue-specific posttranslational processing of the proglucagon peptide.
Glucagon-like peptide 2 receptor and Glucagon-like peptide-1 · Glucagon-like peptide-1 and Neurotransmitter ·
Glucagon-like peptide-2
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans.
Glucagon-like peptide 2 receptor and Glucagon-like peptide-2 · Glucagon-like peptide-2 and Neurotransmitter ·
The list above answers the following questions
- What Glucagon-like peptide 2 receptor and Neurotransmitter have in common
- What are the similarities between Glucagon-like peptide 2 receptor and Neurotransmitter
Glucagon-like peptide 2 receptor and Neurotransmitter Comparison
Glucagon-like peptide 2 receptor has 9 relations, while Neurotransmitter has 375. As they have in common 4, the Jaccard index is 1.04% = 4 / (9 + 375).
References
This article shows the relationship between Glucagon-like peptide 2 receptor and Neurotransmitter. To access each article from which the information was extracted, please visit:
